C-Type Natriuretic Peptide (1-53) (human) Natriuretic Peptides Catalog

CAS	141294-77-1
Sequence	H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH (Disulfide bond)
Sequence Single	DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
Molecular Formula	C251H417N81O71S3
Molecular Weight	5801.77
Synonyms	CNP-53 (human), C-Type Natriuretic Peptide (1-53), human
Technology	Synthetic
Storage	-20°C, avoid light, cool and dry place
Application	Cardiovascular System & Diseases\|Regenerative Medicine
Description	C-Type Natriuretic Peptide (1-53) (human) also called CNP-53 (human), C-Type Natriuretic Peptide (1-53), human, is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.
References	1. Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. W.E.Schmidt et al., Proc. Natl. Acad. Sci. USA, 88, 11435 (1991) 2. N-terminally extended form of C-type natriuretic peptide (CNP-53) identified in porcine brain. Minamino N, et al. Biochem Biophys Res Commun. 1990 Jul 31;170(2):973-9.

PeptideDB