PeptideDB

BNP-45 (rat)

CAS No.: 123337-89-3

BNP-45 (rat) also called Brain Natriuretic Peptide-45 (rat), BNP (1-45), rat, is a circulating form of rat brain natriur
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 123337-89-3
Sequence H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (Disulfide bond)
Sequence Single SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Molecular Formula C213H349N71O65S3
Molecular Weight 5040.75
Synonyms Brain Natriuretic Peptide-45 (rat), BNP (1-45), rat
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Regenerative Medicine
Description BNP-45 (rat) also called Brain Natriuretic Peptide-45 (rat), BNP (1-45), rat, is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.
References 1.  Effects of brain natriuretic peptide-45, a circulating form of rat brain natriuretic peptide, in spontaneously hypertensive rats. Kita T, et al. Eur J Pharmacol. 1991 Sep 4;202(1):73-9.