PeptideDB

BNP-32 (human)

CAS No.: 124584-08-3

BNP-32 (human) also called Brain Natriuretic Peptide-32 (human), Nesiritide, BNP (1-32), human, is an agonist of natriur
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 124584-08-3
Sequence H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide bond)
Sequence Single SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Molecular Formula C143H244N50O42S4
Molecular Weight 3464.09
Synonyms Brain Natriuretic Peptide-32 (human), Nesiritide, BNP (1-32), human, 奈西立肽
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Cardiovascular System & Diseases|Regenerative Medicine
Description BNP-32 (human) also called Brain Natriuretic Peptide-32 (human), Nesiritide, BNP (1-32), human, is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. The secretion of the cardiac hormone BNP-32 is increased considerably in patients with congestive heart failure, successful medical treatment of this condition will result in a decrease. Yandle et al. described a method for determining hBNP in human plasma. Effects of hBNP infusion in humans have been described by Holmes et al and La Villa et al. BNP is an important biomarker in the diagnosis of heart diseases. Additionally, BNP-32 may act as a neuropeptide. BNP-32 exerts strong lipolytic effects in humans.
References 1.  Selective Binding of the Dipeptides L-Phe-D-Pro and D-Phe-L-Pro to β-Cyclodextrin. M.Maletic et al., Angew. Chem. Int. Ed. Engl., 35, 1490 (1996) 2.  Histamine release induced by human natriuretic peptide from rat peritoneal mast cells. H.Yoshida et al., Regul. Pept., 61, 45 (1996) 3.  Assay of brain natriuretic peptide (BNP) in human plasma: evidence for high molecular weight BNP as a major plasma component in heart failure. T.G.Yandle et al., J. Clin. Endocrinol. Metab., 76, 832 (1993) 4.  BNP as a biomarker in heart disease. O.Vuolteenaho et al., Adv. Clin. Chem., 40, 1 (2005) 5.  Natriuretic peptides: a new lipolytic pathway in human adipocytes. C.Sengenes et al., FASEB J., 14, 1345 (2000) 6.  Cardiovascular and renal effects of low dose brain natriuretic peptide infusion in man. G.La Villa et al., J. Clin. Endocrinol. Metab., 78, 1166 (1994) 7.  Renal, endocrine, and hemodynamic effects of human brain natriuretic peptide in normal man. S.J.Holmes et al., J. Clin. Endocrinol. Metab., 76, 91 (1993) 8.  Molecular biology of the natriuretic peptides and their receptors. Koller KJ, et al. Circulation. 1992 Oct;86(4):1081-8. 9.  ProBNP(1-108) is resistant to degradation and activates guanylyl cyclase-A with reduced potency. Dickey DM, et al. Clin Chem. 2011 Sep;57(9):1272-8.