PeptideDB

BNP-32 (rat)

CAS No.: 133448-20-1

BNP-32 (rat) also called Brain Natriuretic Peptide-32 (rat), BNP (1-32), rat, is a 32 amino acid polypeptide secreted by
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 133448-20-1
Sequence H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (Disulfide bond)
Sequence Single NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Molecular Formula C146H239N47O44S3
Molecular Weight 3452.99
Synonyms Brain Natriuretic Peptide-32 (rat), BNP (1-32), rat
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Regenerative Medicine
Description BNP-32 (rat) also called Brain Natriuretic Peptide-32 (rat), BNP (1-32), rat, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).
References 1.  Gut adaptation and the glucagon-like peptides. D.J.Drucker, Gut, 50, 428 (2002) 2.  B-type natriuretic peptide prevents acute hypertrophic responses in the diabetic rat heart: importance of cyclic GMP. A.C.Rosenkranz, Diabetes, 52, 2389 (2003) 3.  Human B-type natriuretic peptide is not degraded by meprin A. Dickey DM, et al. Biochem Pharmacol. 2010 Oct 1;80(7):1007-11. 4.  Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3’,5’-cyclic monophosphate in ependymal cells ex vivo. Wellard J, et al. Neurosci Lett. 2006 Jan 16;392(3):187-92. 5.  Potentiation of brain natriuretic peptides by SQ 28,603, an inhibitor of neutral endopeptidase3.4.24.11, in monkeys and rats. Seymour AA, et al. J Pharmacol Exp Ther. 1992 Jul;262(1):60-70.