| CAS | 133448-20-1 |
| Sequence | H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (Disulfide bond) |
| Sequence Single | NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF |
| Molecular Formula | C146H239N47O44S3 |
| Molecular Weight | 3452.99 |
| Synonyms | Brain Natriuretic Peptide-32 (rat), BNP (1-32), rat |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Regenerative Medicine |
| Description | BNP-32 (rat) also called Brain Natriuretic Peptide-32 (rat), BNP (1-32), rat, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes). |
| References | 1. Gut adaptation and the glucagon-like peptides. D.J.Drucker, Gut, 50, 428 (2002) 2. B-type natriuretic peptide prevents acute hypertrophic responses in the diabetic rat heart: importance of cyclic GMP. A.C.Rosenkranz, Diabetes, 52, 2389 (2003) 3. Human B-type natriuretic peptide is not degraded by meprin A. Dickey DM, et al. Biochem Pharmacol. 2010 Oct 1;80(7):1007-11. 4. Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3’,5’-cyclic monophosphate in ependymal cells ex vivo. Wellard J, et al. Neurosci Lett. 2006 Jan 16;392(3):187-92. 5. Potentiation of brain natriuretic peptides by SQ 28,603, an inhibitor of neutral endopeptidase3.4.24.11, in monkeys and rats. Seymour AA, et al. J Pharmacol Exp Ther. 1992 Jul;262(1):60-70. |