| Bioactivity | β-Amyloid (1-43)(human) TFA is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) TFA shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) TFA could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use[1]. |
| Name | β-Amyloid (1-43)(human) TFA |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr |
| Shortening | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT |
| Formula | C209H319F3N56O64S |
| Molar Mass | 4729.21 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Müller WE, et al., Effects of beta-amyloid peptides on the fluidity of membranes from frontal and parietal lobes of human brain. High potencies of A beta 1-42 and A beta 1-43. Amyloid. 1998;5(1):10-15. |
β-Amyloid (1-43)(human) TFA
CAS: F: C209H319F3N56O64S W: 4729.21
β-Amyloid (1-43)(human) TFA is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.