PeptideDB

Phrixotoxin 3-NH2 TFA

CAS: F: C176H270N52O47S6.xC2HF3O2 W: 4058.74 (free base)

Phrixotoxin 3-NH2 TFA is a derivative of Phrixotoxin 3 TFA (HY-P1218A). Phrixotoxin 3 TFA is a potent blocker of voltage
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Phrixotoxin 3-NH2 TFA is a derivative of Phrixotoxin 3 TFA (HY-P1218A). Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current[1].
Sequence Asp-Cys-Leu-Gly-Phe-Leu-Trp-Lys-Cys-Asn-Pro-Ser-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Gln-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
Shortening DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
Formula C176H270N52O47S6.xC2HF3O2
Molar Mass 4058.74 (free base)
Appearance 固体
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Reference [1]. Bosmans F, et, al. Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Comparative Study Mol Pharmacol. 2006 Feb; 69(2): 419-29.