| Bioactivity | Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist. | ||||||
| Target | Neuropeptide Y (NPY) Y4/Y5 receptor | ||||||
| Invitro | Human pancreatic polypeptide (hPP) is one such peptide, being released postprandially from F cells of the pancreatic islets depending on caloric load, food consumption and circadian rhythm. It is a C-terminally amidated 36 amino acid peptide with a characteristic hairpin-like pancreatic polypeptide (PP)-fold and acts at the Y4 receptor to induce satiety and delay gastric emptying and motility[1]. Addition of the human pancreatic polypeptide (hPP) (10 nM-1 μM) results in a significant, dose-dependent reduction in both basal and stimulated release. Human pancreatic polypeptide (hPP) can also inhibit basal and stimulated NPY release with a pharmacological profile suggesting a role for Y4 presynaptic receptors[2]. | ||||||
| Name | Pancreatic Polypeptide, human | ||||||
| CAS | 75976-10-2 | ||||||
| Sequence | Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 | ||||||
| Shortening | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 | ||||||
| Formula | C185H287N53O54S2 | ||||||
| Molar Mass | 4181.71 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Thieme V, et al. High molecular weight PEGylation of human pancreatic polypeptide at position 22 improvesstability and reduces food intake in mice. Br J Pharmacol. 2016 Nov;173(22):3208-3221. [2]. King PJ, et al. Regulation of neuropeptide Y release by neuropeptide Y receptor ligands and calcium channel antagonists in hypothalamic slices. J Neurochem. 1999 Aug;73(2):641-6. |