| Bioactivity | Nesiritide (Brain Natriuretic Peptide-32 human) is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. | ||||||
| Invitro | Nesiritide (Brain Natriuretic Peptide-32 human) is an agonist of natriuretic peptide receptor (NPR), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively[1]. ProBNP1-108 stimulates guanylyl cyclase-A (GC-A) to near-maximum activities but is 13-fold less potent than Nesiritide (BNP1-32). ProBNP1-108 binds human GC-A 35-fold less tightly than Nesiritide. Neither proBNP1–108 nor Nesiritide activates GC-B. The natriuretic peptide clearance receptor binds proBNP1-108 3-fold less tightly than Nesiritide. The half time for degradation of proBNP1-108 by human kidney membranes is 2.7-fold longer than for Nesiritide, and the time required for complete degradation is 6-fold longer. Nesiritide and proBNP1-108 are best fitted by first- and second-order exponential decay models, respectively[2]. | ||||||
| Name | Nesiritide | ||||||
| CAS | 124584-08-3 | ||||||
| Sequence | Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys10-Cys26) | ||||||
| Shortening | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys10-Cys26) | ||||||
| Formula | C143H244N50O42S4 | ||||||
| Molar Mass | 3464.04 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
Nesiritide
CAS: 124584-08-3 F: C143H244N50O42S4 W: 3464.04
Nesiritide (Brain Natriuretic Peptide-32 human) is an agonist of natriuretic peptide receptors (NPRs), with Kd values of
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.