| Bioactivity | LL-37 amide is a positively charged antimicrobial peptide. LL-37 amide has anticancer activity and can be used for cancer research[1][2]. |
| Name | LL-37 amide |
| CAS | 597562-32-8 |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2 |
| Shortening | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2 |
| Formula | C205H341N61O52 |
| Molar Mass | 4492.28 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Papo N, et al. New lytic peptides based on the D,L-amphipathic helix motif preferentially kill tumor cells compared to normal cells. Biochemistry. 2003 Aug 12;42(31):9346-54. [2]. Reinhardt A, et al. Novel imidazolium salt--peptide conjugates and their antimicrobial activity. Bioconjug Chem. 2014 Dec 17;25(12):2166-74. |