LL-37 amide_product_DataBase

CAS: 597562-32-8 F: C205H341N61O52 W: 4492.28

LL-37 amide is a positively charged antimicrobial peptide. LL-37 amide has anticancer activity and can be used for cance

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	LL-37 amide is a positively charged antimicrobial peptide. LL-37 amide has anticancer activity and can be used for cancer research[1][2].
Name	LL-37 amide
CAS	597562-32-8
Sequence	Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
Shortening	LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2
Formula	C205H341N61O52
Molar Mass	4492.28
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Papo N, et al. New lytic peptides based on the D,L-amphipathic helix motif preferentially kill tumor cells compared to normal cells. Biochemistry. 2003 Aug 12;42(31):9346-54. [2]. Reinhardt A, et al. Novel imidazolium salt--peptide conjugates and their antimicrobial activity. Bioconjug Chem. 2014 Dec 17;25(12):2166-74.

PeptideDB