| Bioactivity | Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin[1]. |
| Name | Gastric Inhibitory Polypeptide (1-30), porcine |
| CAS | 134875-67-5 |
| Shortening | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK |
| Formula | C162H244N40O48S |
| Molar Mass | 3551.97 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Krarup T, et al. Effect of porcine gastric inhibitory polypeptide on beta-cell function in type I and type II diabetes mellitus. Metabolism. 1987 Jul;36(7):677-82. [2]. G W Morrow, et al. The insulinotropic region of gastric inhibitory polypeptide; fragment analysis suggests the bioactive site lies between residues 19 and 30. Canadian Journal of Physiology and Pharmacology. January 1996. Volume 74. |