PeptideDB

Gastric Inhibitory Polypeptide (1-30), porcine

CAS: 134875-67-5 F: C162H244N40O48S W: 3551.97

Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin[1].
Name Gastric Inhibitory Polypeptide (1-30), porcine
CAS 134875-67-5
Shortening YAEGTFISDYSIAMDKIRQQDFVNWLLAQK
Formula C162H244N40O48S
Molar Mass 3551.97
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Krarup T, et al. Effect of porcine gastric inhibitory polypeptide on beta-cell function in type I and type II diabetes mellitus. Metabolism. 1987 Jul;36(7):677-82. [2]. G W Morrow, et al. The insulinotropic region of gastric inhibitory polypeptide; fragment analysis suggests the bioactive site lies between residues 19 and 30. Canadian Journal of Physiology and Pharmacology. January 1996. Volume 74.