| Bioactivity | Human PTH-(1-31) amide is a PTH analog. Human PTH-(1-31) amide stimulate phosphatidylcholine hydrolysis and stimulates adenylyl cyclase release[1]. |
| Name | Human PTH-(1-31) amide |
| CAS | 173833-08-4 |
| Sequence | Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-NH2 |
| Shortening | SVSEIQLMHNGKHLNSMERVEWLRKKLQDV-NH2 |
| Formula | C162H270N50O46S2 |
| Molar Mass | 3718.31 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Singh AT, et al. Parathyroid hormone (PTH)-(1-34), [Nle(8,18),Tyr34]PTH-(3-34) amide, PTH-(1-31) amide, and PTH-related peptide-(1-34) stimulate phosphatidylcholine hydrolysis in UMR-106 osteoblastic cells: comparison with effects of phorbol 12,13-dibutyrate. Endocrinology. 1999 Jan;140(1):131-7. |
Human PTH-(1-31) amide
CAS: 173833-08-4 F: C162H270N50O46S2 W: 3718.31
Human PTH-(1-31) amide is a PTH analog. Human PTH-(1-31) amide stimulate phosphatidylcholine hydrolysis and stimulates a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.