PeptideDB

Human PTH-(1-31) amide

CAS: 173833-08-4 F: C162H270N50O46S2 W: 3718.31

Human PTH-(1-31) amide is a PTH analog. Human PTH-(1-31) amide stimulate phosphatidylcholine hydrolysis and stimulates a
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Human PTH-(1-31) amide is a PTH analog. Human PTH-(1-31) amide stimulate phosphatidylcholine hydrolysis and stimulates adenylyl cyclase release[1].
Name Human PTH-(1-31) amide
CAS 173833-08-4
Sequence Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-NH2
Shortening SVSEIQLMHNGKHLNSMERVEWLRKKLQDV-NH2
Formula C162H270N50O46S2
Molar Mass 3718.31
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Singh AT, et al. Parathyroid hormone (PTH)-(1-34), [Nle(8,18),Tyr34]PTH-(3-34) amide, PTH-(1-31) amide, and PTH-related peptide-(1-34) stimulate phosphatidylcholine hydrolysis in UMR-106 osteoblastic cells: comparison with effects of phorbol 12,13-dibutyrate. Endocrinology. 1999 Jan;140(1):131-7.