| Bioactivity | Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials[1]. |
| Name | Heteropodatoxin-2 |
| CAS | 741730-12-1 |
| Sequence | Asp-Asp-Cys-Gly-Lys-Leu-Phe-Ser-Gly-Cys-Asp-Thr-Asn-Ala-Asp-Cys-Cys-Glu-Gly-Tyr-Val-Cys-Arg-Leu-Trp-Cys-Lys-Leu-Asp-Trp-NH2 (Disulfide bridge:Cys3-Cys17;Cys10-Cys22;Cys16-Cys26) |
| Shortening | DDCGKLFSGCDTNADCCEGYVCRLWCKLDW-NH2 (Disulfide bridge:Cys3-Cys17;Cys10-Cys22;Cys16-Cys26) |
| Formula | C144H207N39O46S6 |
| Molar Mass | 3412.81 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. M C Sanguinetti, et al. Heteropodatoxins: peptides isolated from spider venom that block Kv4.2 potassium channels. Mol Pharmacol. 1997 Mar;51(3):491-8. |
Heteropodatoxin-2
CAS: 741730-12-1 F: C144H207N39O46S6 W: 3412.81
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed i
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.