PeptideDB

Haplotoxin-2

CAS: F: C161H248N46O43S6 W: 3708.36

Haplotoxin-2 is a peptide toxin that can be isolated from Haplopelma lividum.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Haplotoxin-2 is a peptide toxin that can be isolated from Haplopelma lividum[1].
Name Haplotoxin-2
Sequence Ala-Cys-Lys-Gly-Leu-Phe-Val-Thr-Cys-Thr-Pro-Gly-Lys-Asp-Glu-Cys-Cys-Pro-Asn-His-Val-Cys-Ser-Ser-Lys-His-Lys-Trp-Cys-Lys-Tyr-Lys-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Shortening ACKGLFVTCTPGKDECCPNHVCSSKHKWCKYKI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Formula C161H248N46O43S6
Molar Mass 3708.36
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Zhang YY, et al. Structural and Functional Diversity of Peptide Toxins from Tarantula Haplopelma hainanum (Ornithoctonus hainana) Venom Revealed by Transcriptomic, Peptidomic, and Patch Clamp Approaches. J Biol Chem. 2015 May 29;290(22):14192-207.