| Bioactivity | Haplotoxin-2 is a peptide toxin that can be isolated from Haplopelma lividum[1]. |
| Name | Haplotoxin-2 |
| Sequence | Ala-Cys-Lys-Gly-Leu-Phe-Val-Thr-Cys-Thr-Pro-Gly-Lys-Asp-Glu-Cys-Cys-Pro-Asn-His-Val-Cys-Ser-Ser-Lys-His-Lys-Trp-Cys-Lys-Tyr-Lys-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29) |
| Shortening | ACKGLFVTCTPGKDECCPNHVCSSKHKWCKYKI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29) |
| Formula | C161H248N46O43S6 |
| Molar Mass | 3708.36 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Zhang YY, et al. Structural and Functional Diversity of Peptide Toxins from Tarantula Haplopelma hainanum (Ornithoctonus hainana) Venom Revealed by Transcriptomic, Peptidomic, and Patch Clamp Approaches. J Biol Chem. 2015 May 29;290(22):14192-207. |