PeptideDB

GLP-2(3-33)

CAS: 275801-62-2 F: C156H242N40O53S W: 3557.89

GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM)[1][2].
Invitro GLP-2 is secreted as a 33-amino acid peptide, but is rapidly degraded at an N-terminus site to GLP-2(3-33) in circulation, in large part, by dipeptidylpeptidase IV (DPPIV). GLP-2 (3-33) acts as a partial agonist with potential competitive antagonistic properties on the GLP-2 receptor. In the GLP-2 receptor-binding assay, the binding IC50 for GLP-2 1–33 was 3.1 nM, and it was 41 nM for GLP-2 3-33. Thus, GLP-2 3–33 had 7.5% binding affinity compared to GLP-2 1-33[1].
Name GLP-2(3-33)
CAS 275801-62-2
Shortening DGSFSDEMNTILDNLAARDFINWLIQTKITD
Formula C156H242N40O53S
Molar Mass 3557.89
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)