| CAS | 1926163-15-6 |
| Sequence | H-Cys-Gly-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Glu-Gln-Lys-Cys-Ala-Glu-Cys-Cys-Gly-Gly-Ile-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Asn-Arg-NH2 (Disulfide bonds between Cys1 and Cys18/Cys4 and Cys25/Cys15 and Cys30/Cys19 and Cys32) |
| Sequence Single | CGPCFTTDHQMEQKCAECCGGIGKCYGPQCLCNR-NH2 |
| Molecular Formula | C147H24N46O47S9 |
| Molecular Weight | 3676.27 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Ion Channel Modulating Agents |
| Description | Toxin GaTx1 is a component of the venom of the yellow scorpion (Leiurus quinquestriatus hebraeus). Toxin GaTx1 is a chloride channel ligand, it potently and reversibly inhibits cystic fibrosis transmembrane conductance regulator (CFTR) chloride channels when the channels are in the interburst closed state. Since Toxin GaTx1 inhibits CFTR only when applied to the cytoplasmic side, it is unlikely that CFTR represents the native target. Manufactured and sold under license from Georgia Tech Research Corporation, USA; patent WO/2007/137163 (PCT/US2007/069243). |