PeptideDB

TIP-39

CAS No.: 277302-47-3

Tuberoinfundibular peptide, TIP-39, originally isolated from bovine hypothalamus was found to be a potent and selective
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 277302-47-3
Sequence H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH
Sequence Single SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Molecular Formula C202H325N61O54S
Molecular Weight 4504.25
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Description Tuberoinfundibular peptide, TIP-39, originally isolated from bovine hypothalamus was found to be a potent and selective agonist of the pTH2 receptor which regulates pituitary hormone secretion and spinal cord regions involved in pain perception. Synthetic TIP-39 activated the human and rat pTH2 receptors with EC50 of 0.5 ± 0.12 nM and 0.8 ± 0.3 nM, respectively. TIP-39 was much more potent than pTH (EC50 = 49 ± 23 nM) at the rat pTH2 receptor. The discovery of TIP-39 provides an important tool for the investigation of the pTH2 receptor functions inside and outside the nervous system.
References 1.  Immunostimulation by bacterial components: I. Activation Of macrophages and enhancement of genetic immunization by the lipopeptide P3CSK4. U.v.d.Esche et al., Int. J. Immunopharmacol., 22, 1093 (2000) 2.  Agonist-specific regulation of parathyroid hormone (PTH) receptor type 2 activity: structural and functional analysis of PTH- and tuberoinfundibular peptide (TIP) 39-stimulated desensitization and internalization. A.Bisello et al., Mol. Endocrinol., 18, 1486 (2004) 3.  TIP39: a new neuropeptide and PTH2-receptor agonist from hypothalamus. T.B.Usdin et al., Nat. Neurosci., 2, 941 (1999) 4.  Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor. Della Penna K, et al. Neuropharmacology. 2003 Jan;44(1):141-53.