| CAS | 115966-23-9/118812-69-4 |
| Sequence | H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (Disulfide bond) |
| Sequence Single | TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY |
| Molecular Formula | C145H234N52O44S3 |
| Molecular Weight | 3505.98 |
| Synonyms | Urodilatin, Ularitide, Urodilatin (95-126) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cardiovascular System & Diseases |
| Description | Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) also called Urodilatin, Ularitide, Urodilatin (95-126), a 32 amino acid peptide, has originally been isolated from human urine. It belongs to the family of natriuretic-vasorelaxant peptides earlier found in heart atria. Cedidi et al. showed that urodilatin infusion may represent a concept for the treatment of therapy-resistant acute renal failure after liver transplantation. The use of this product is protected by patents. It is sold by HongTide for research purposes only. |
| References | 1. The amino acid sequence of an atrial peptide with potent diuretic and natriuretic properties. T.G.Flynn et al., Biochem. Biophys. Res. Commun., 117, 859 (1983) 2. Urodilatin: a new approach for the treatment of therapy-resistant acute renal failure after liver transplantation. C.Cedidi et al., Eur. J. Clin. Invest., 24, 632 (1994) 3. Hydrolysis of human and pig brain natriuretic peptides, urodilatin, C-type natriuretic peptide and some C-receptor ligands by endopeptidase-24.11. A.J.Kenny et al., Biochem. J., 291, 83 (1993) 4. Urodilatin (CDD/ANP-95-126) is not biologically inactivated by a peptidase from dog kidney cortex membranes in contrast to atrial natriuretic peptide/cardiodilatin (alpha-hANP/CDD-99-126). M.Gagelmann et al., FEBS Lett., 233, 249 (1988) 5. Type A natriuretic peptides exhibit different bronchoprotective effects in rats. T.Flüge et al., Eur. J. Pharmacol., 271, 395 (1994) |
Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine)
CAS No.: 115966-23-9/118812-69-4
Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) also called Urodilatin, Ularitide, Urodilatin
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.