Tau Peptide (306-336) (Repeat 3 Domain) Tau Fragments Catalog

CAS	330456-26-3
Sequence	H-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-Leu-Ser-Lys-Val-Thr-Ser-Lys-Cys-Gly-Ser-Leu-Gly-Asn-Ile-His-His-Lys-Pro-Gly-Gly-Gly-Gln-OH
Sequence Single	VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
Molecular Formula	C143H236N42O42S
Molecular Weight	3247.77
Technology	Synthetic
Storage	-20°C, avoid light, cool and dry place
Application	Tau Peptides
Description	Tau Peptide (306-336) (Repeat 3 Domain) is the amphipathic helical structure of the third fragment (306-336), in the four-repeat microtubule-binding domain of tau attaching with a biotin. This structure is hypothesized to be responsible for the formation of the neuropathological filament.
References	1. The synthesis of ‘difficult’ peptides using 2-hydroxy-4-methoxybenzyl or pseudoproline amino acid building blocks: a comparative study. W.R.Sampson et al., J. Pept. Sci., 5, 403 (1999) 2. Domains of tau protein, differential phosphorylation, and dynamic instability of microtubules. B.Trinczek et al., Mol. Biol. Cell, 6, 1887 (1995) 3. Binding of copper (II) ion to an Alzheimer’s tau peptide as revealed by MALDI-TOF MS, CD, and NMR. Q.-F.Ma et al., Biopolymers, 79, 74 (2005)

PeptideDB