| CAS | 172450-46-3 |
| Sequence | H-Arg-Ser-Cys-Ile-Asp-Thr-Ile-Pro-Lys-Ser-Arg-Cys-Thr-Ala-Phe-Gln-Cys-Lys-His-Ser-Met-Lys-Tyr-Arg-Leu-Ser-Phe-Cys-Arg-Lys-Thr-Cys-Gly-Thr-Cys-OH (Disulfide bonds between Cys3 and Cys35/Cys12 and Cys28/Cys17 and Cys32) |
| Sequence Single | RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC |
| Molecular Formula | C169H274N54O48S7 |
| Molecular Weight | 4054.83 |
| Synonyms | ShK |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Ion Channel Modulating Agents |
| Description | Stichodactyla helianthus Neurotoxin (ShK), originally isolated from the sea anemone Stichodactyla helianthus, has been found to inhibit the specific binding of dendrotoxin I to rat brain membranes. Due to its unique structure (it contains three intramolecular disulfide bridges) and high affinity for some potassium channels, Stichodactyla helianthus Neurotoxin (ShK) may become a useful molecular probe for investigating potassium channels. |
| References | 1. Specific high affinity binding sites for somatostatin-28 on pancreatic beta-cells: differences with brain somatostatin receptors. J.-C.Reubi et al., Endocrinology, 110, 1049 (1982) 2. Solution structure of ShK toxin, a novel potassium channel inhibitor from a sea anemone. J.E.Tudor et al., Nat. Struct. Biol., 3, 317 (1996) 3. Ionisation behaviour and solution properties of the potassium-channel blocker ShK toxin. J.E.Tudor et al., Eur. J. Biochem., 251, 133 (1998) 4 . An essential binding surface for ShK toxin interaction with rat brain potassium channels. M.W.Pennington et al., Peptides: Chemistry, Structure and Biology, p. 192, P.T.P.Kaumaya and R.S.Hodges, eds., Mayflower Scientific Ltd., (1996) 5. Identification of three separate binding sites on SHK toxin, a potent inhibitor of voltage-dependent potassium channels in human T-lymphocytes and rat brain. M.W.Pennington et al., Biochemistry, 35, 16407 (1996) 6. Designed peptide analogues of the potassium channel blocker ShK toxin. M.W.Pennington et al., Biochem. Biophys. Res. Commun., 219, 696 (1996) |