| CAS | 149146-12-3 |
| Sequence | H-Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln-OH |
| Sequence Single | TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
| Molecular Formula | C159H252N40O58 |
| Molecular Weight | 3651.98 |
| Synonyms | Secretogranin II (154-186) (mouse, rat) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Alzheimer’s Disease |
| Description | Secretoneurin (mouse, rat) also called Secretogranin II (154-186) (mouse, rat), a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin (mouse, rat) induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes. |