| CAS | 215510-22-8 |
| Sequence | H-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
| Sequence Single | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 |
| Molecular Formula | C160H252N56O42S |
| Molecular Weight | 3664.18 |
| Synonyms | PrRP31 (human), Preprolactin (23-53) (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Prolactin-Releasing Peptide (1-31) (human) also called PrRP31 (human), Preprolactin (23-53) (human), is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin-Releasing Peptide (1-31) (human) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin-Releasing Peptide (1-31) (human) can be used for the research of the hypothalamo-pituitary axis. |
| References | 1. Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor. Langmead CJ, et al. Br J Pharmacol. 2000 Oct;131(4):683-8. 2. Prolactin releasing peptide (PrRP) stimulates luteinizing hormone (LH) and follicle stimulating hormone (FSH) via a hypothalamic mechanism in male rats. L J Seal, et al. Endocrinology. 2000 May;141(5):1909-12. |
Prolactin-Releasing Peptide (1-31) (human)
CAS No.: 215510-22-8
Prolactin-Releasing Peptide (1-31) (human) also called PrRP31 (human), Preprolactin (23-53) (human), is a high affinity
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.