PeptideDB

Prokineticin 2 Isoform 2 (human)

CAS No.: 423206-00-2

Prokineticin 2 Isoform 2 (human) also called Bv8, is one of the first neuropeptides that appears to directly convey circ
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 423206-00-2
Sequence H-Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys-OH (Disulfide bonds, air oxidized)
Sequence Single AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Molecular Formula C379H606N114O101S13
Molecular Weight 8792.55
Synonyms Bv8
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Description Prokineticin 2 Isoform 2 (human) also called Bv8, is one of the first neuropeptides that appears to directly convey circadian rhythm signaling to other CNS structures and, therefore, it may be a critical output molecule regulating biological rhythms. The peptide has the capacity to strongly suppress nocturnal locomotor activity. Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus. Prokineticin 2 Isoform 2 (human) binds to the G-protein-coupled receptor PKR2. Gardiner et al. showed that prokineticin 2 potently inhibits food intake.
References 1.  Design, synthesis, and pharmacological activities of dynorphin A analogues cyclized by ring-closing metathesis. W.J.Fang et al., J. Med. Chem., 52, 5619 (2009) 2.  Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus. M.-Y.Cheng et al., Nature, 417, 405 (2002) 3.  Prokineticin 2 modulates the excitability of subfornical organ neurons. G.T.Cottrell et al., J. Neurosci., 24, 2375 (2004) 4.  Prokineticin 2 and circadian clock output. Q.Y.Zhou and M.Y.Cheng, FEBS J., 272, 5703 (2005)