Prepro-Atrial Natriuretic Factor (26-55) (human) Natriuretic Peptides Catalog

CAS	112160-82-4
Sequence	H-Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp-OH
Sequence Single	NPMYNAVSNADLMDFKNLLDHLEEKMPLED
Molecular Formula	C152H236N38O51S3
Molecular Weight	3507.97
Synonyms	Prepro-hANF (26-55) Cardiodilatin-Related Peptide (human), NT-pro-ANP (human) (1-30), Prepro-ANF (26-55), human
Technology	Synthetic
Storage	-20°C, avoid light, cool and dry place
Application	Cardiovascular System & Diseases
Description	Prepro-Atrial Natriuretic Factor (26-55) (human) also called Prepro-hANF (26-55) Cardiodilatin-Related Peptide (human), NT-pro-ANP (human) (1-30), Prepro-ANF (26-55), human, is one of four peptide hormones derived from the atrial natriuretic prohormone. It is also known as long acting natriuretic peptide. The peptide has potent vasodilatory properties equal to atrial natriuretic factor. Vasodilation is associated with a 4-5 fold increase in cyclic GMP levels due to activation of particulate guanylate cyclase activity. Like prepro-atrial natriuretic factor (56-92) and kaliuretic peptide it is present in higher concentration in individuals with congestive heart failure. It causes the maximal increase in prostaglandin E2 (PGE2) levels of the three peptides. The known increase in PGE2 in chronic heart failure may be in part secondary to these peptides.
References	1. Molecular diversity of a putative virulence factor: purification and characterization of isoforms of an extracellular serine glutamyl endopeptidase of Enterococcus faecalis with different enzymatic activities. M.Kawalec et al., J. Bacteriol., 187, 266 (2005) 2. Vessel dilator, long acting natriuretic peptide, and kaliuretic peptide increase circulating prostaglandin E2. D.L.Vesely et al., Life Sci., 66, 905 (2000)

PeptideDB

Prepro-Atrial Natriuretic Factor (26-55) (human)

CAS No.: 112160-82-4