Dendroaspis Natriuretic Peptide Natriuretic Peptides Catalog

CAS	255721-52-9
Sequence	H-Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala-OH (Disulfide bond)
Sequence Single	EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA
Molecular Formula	C180H282N56O56S2
Molecular Weight	4190.69
Synonyms	DNP
Technology	Synthetic
Storage	-20°C, avoid light, cool and dry place
Application	Cardiovascular System & Diseases
Description	Dendroaspis Natriuretic Peptide also called DNP, is a 38 amino acid peptide originally isolated from the venom of the green mamba snake (Dendroaspis angusticeps), it shares structural homology with the family of natriuretic peptides. DNP contains a 17 amino acid disulfide ring similar to ANP, BNP, and CNP, which mediate biological actions through particulate guanylyl cyclase receptors and generation of guanosine monophosphate (cGMP).
References	1. Vasodilatory effect of tuberoinfundibular peptide (TIP39): requirement of receptor desensitization and its beneficial effect in the post-ischemic heart. G.Ross et al., Peptides, 28, 878 (2007) 2. Mechanism of relaxations to dendroaspis natriuretic peptide in canine coronary arteries. E.Collins et al., J. Cardiovasc. Pharmacol., 35, 614 (2000) 3. A new member of the natriuretic peptide family is present in the venom of the green mamba (Dendroaspis angusticeps). H.Schweitz et al., J. Biol. Chem., 267, 13928 (1992)

PeptideDB