| CAS | 123583-37-9 |
| Sequence | H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Single | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Molecular Formula | C180H279N53O54 |
| Molecular Weight | 4049.52 |
| Synonyms | PYY (3-36) (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Gastrointestinal Research|Obesity Research |
| Description | Peptide YY (3-36) (human) also called PYY (3-36) (human), is a Y2 receptor agonist, it is released from the body’s gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in ‘longer term’ regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity. |
| References | 1. Rapid alterations in the plasma membrane structure of macrophages stimulated with bacterial lipopeptides. B.Uhl et al., Eur. J. Cell Biol., 58, 90 (1992) 2. Peptide YY(3-36) inhibits both anorexigenic proopiomelanocortin and orexigenic neuropeptide Y neurons: implications for hypothalamic regulation of energy homeostasis. C.Acuna-Goycolea and A.N.van den Pol, J. Neurosci., 25, 10510 (2005) 3. Peptide YY(1-36) and peptide YY(3-36): Part I. Distribution, release and actions. G.H.Ballantyne, Obes. Surg., 16, 651 (2006) 4. Reversible PEGylation of peptide YY3-36 prolongs its inhibition of food intake in mice. Y.Shechter et al., FEBS Lett., 579, 2439 (2005) 5. Inhibition of food intake in obese subjects by peptide YY3-36. R.L.Batterham et al., N. Engl. J. Med., 349, 941 (2003) 6. Peripheral administration of PYY(3-36) produces conditioned taste aversion in mice. I.G.Halatchev and R.D.Cone, Cell Metab., 1, 159 (2005) 7. A new molecular form of PYY: structural characterization of human PYY(3-36) and PYY(1-36). G.A.Eberlein et al., Peptides, 10, 797 (1989) 8. Gut hormone PYY(3-36) physiologically inhibits food intake. R.L.Batterham et al., Nature, 418, 650 (2002) 9. NPY Y2 receptor agonist PYY(3-36) inhibits diarrhea by reducing intestinal fluid secretion and slowing colonic transit in mice. Moriya R, et al. Peptides. 2010;31(4):671-675. |