| CAS | 126339-09-1 |
| Sequence | H-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Single | AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 |
| Molecular Formula | C176H272N52O54 |
| Molecular Weight | 3980.41 |
| Synonyms | PYY (3-36) (canine, mouse, porcine, rat) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Gastrointestinal Research |
| Description | Peptide YY (3-36) (canine, mouse, porcine, rat) also called PYY (3-36) (canine, mouse, porcine, rat). Peptide YY (3-36) and peptide YY are both synthesized by the gastrointestinal tract and released into the circulation after a meal. Peptide YY (3-36) is a Y2 receptor subtype agonist, whereas peptide YY is non-selective for Y1 and Y2 receptor subtypes. It has been suggested that Y1 and Y2 receptor subtype binding affinities depend on their secondary and tertiary solution state structures. |
| References | 1. A fluorogenic histone deacetylase assay well suited for high-throughput activity screening. D.Wegener et al., Chem. Biol., 10, 61 (2003) 2. Involvement of apolipoprotein A-IV and cholecystokinin1 receptors in exogenous peptide YY3 36-induced stimulation of intestinal feedback. K.L.Whited et al., Endocrinology, 148, 4695 (2007) 3. Effects of different intermittent peptide YY (3-36) dosing strategies on food intake, body weight, and adiposity in diet-induced obese rats. R.D.Reidelberger et al., Am. J. Physiol. Regul. Integr. Comp. Physiol., 295, R449 (2008) 4. Stimulation of NPY Y2 receptors by PYY3-36 reveals divergent cardiovascular effects of endogenous NPY in rats on different dietary regimens. U.Nordheim and K.G.Hofbauer, Am. J. Physiol. Regul. Integr. Comp. Physiol., 286, R138 (2004) 5. Primary structures of PYY, [Pro(34)]PYY, and PYY-(3-36) confer different conformations and receptor selectivity. D.A.Keire et al., Am. J. Physiol., 279, G126 (2000) 6. A role for metalloendopeptidases in the breakdown of the gut hormone, PYY 3-36. Addison ML, et al. Endocrinology. 2011 Dec;152(12):4630-40. |