| CAS | 1872441-58-1 |
| Sequence | H-Asp-Ser-Leu-Leu-Ala-Val-Arg-Trp-Phe-Phe-Ala-Pro-Asp-Gly-Ser-Gln-Glu-Ala-Leu-Met-Val-Lys-Met-Thr-Lys-Leu-Arg-Val-Ile-Gln-Tyr-Tyr-Gly-Asn-Phe-Ser-Arg-Ile-Ala-Asn-Gln-Gln-Arg-Leu-Arg-Leu-Leu-Glu-Glu-OH |
| Sequence Single | DSLLAVRWFFAPDGSQEALMVKMTKLRVIQYYGNFSRIANQQRLRLLEE |
| Molecular Formula | C262H415N73O72S2 |
| Molecular Weight | 5803.76 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Ion Channel Modulating Agents |
| Description | Peptide Lv (rat) has been discovered via a computational bioinformatics-based screening process. Peptide Lv (rat) is expressed in retinal photoreceptor layer, hippocampus, olfactory bulb, cerebellum, cerebral cortex, lung, spleen, liver and intestine. Peptide Lv enhances L-type voltage-gated calcium channel (L-VGCC) currents in retinal photoreceptors. |