| CAS | 75976-10-2 |
| Sequence | H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 |
| Sequence Single | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 |
| Molecular Formula | C185H287N53O54S2 |
| Molecular Weight | 4181.77 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Gastrointestinal Research|Obesity Research |
| Description | Pancreatic Polypeptide (human) is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist. Pancreatic Polypeptide (human) is also a antagonist of CCK, it inhibits pancreatic sedretion. |
| References | 1. Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. Further evidence for an exendin receptor on dispersed acini from guinea pig pancreas. J.Eng et al., J. Biol. Chem., 267, 7402 (1992) 2. High molecular weight PEGylation of human pancreatic polypeptide at position 22 improvesstability and reduces food intake in mice. Thieme V, et al. Br J Pharmacol. 2016 Nov;173(22):3208-3221. 3. Regulation of neuropeptide Y release by neuropeptide Y receptor ligands and calcium channel antagonists in hypothalamic slices. King PJ, et al. J Neurochem. 1999 Aug;73(2):641-6. |
Pancreatic Polypeptide (human)
CAS No.: 75976-10-2
Pancreatic Polypeptide (human) is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.