PACAP-38 (human, mouse, ovine, porcine, rat) PACAP and Fragments Catalog

CAS	124123-15-5
Sequence	H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Sequence Single	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Molecular Formula	C203H331N63O53S
Molecular Weight	4534.32
Synonyms	Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat), PACAP (1-38), human, ovine, rat
Technology	Synthetic
Storage	-20°C, avoid light, cool and dry place
Application	Alzheimer’s Disease
Description	PACAP-38 (human, mouse, ovine, porcine, rat) also called Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat), PACAP (1-38), human, ovine, rat. Kojro et al. observed that the PAC1 agonists PACAP-27 and PACAP-38 strongly increased the activity of α-secretase. Upregulation of this APP-degrading enzyme promotes the non-amyloidogenic processing of APP, i.e. reduces the production of Aβ40/42, and thus may help to prevent Alzheimer’s disease. Nasally applied PACAP-38 in APP[V717I]-transgenic mice additionally enhanced the production of the Aβ-degrading enzyme neprilysin via induction of somatostatin.
References	1. Effects of peptide HI on basal and stimulated insulin and glucagon secretion in the mouse. B.Ahrén and J.Lundquist, Neuropeptides, 11, 159 (1988) 2. Pituitary adenylate cyclase-activating polypeptide and its receptors: from structure to functions. D.Vaudry et al., Pharmacol. Rev., 52, 269 (2000) 3. Isolation of a novel 38 residue-hypothalamic polypeptide which stimulates adenylate cyclase in pituitary cells. A.Miyata et al., Biochem. Biophys. Res. Commun., 164, 567 (1989) 4. PACAP--a multifacetted neuropeptide. J.Fahrenkrug, Chronobiol. Int., 23, 53 (2006) 5. Neuropeptide pituitary adenylate cyclase-activating polypeptide (PACAP) slows down Alzheimer’s disease-like pathology in amyloid precursor protein-transgenic mice. D.Rat et al., FASEB J., 25, 3208 (2011)

PeptideDB

PACAP-38 (human, mouse, ovine, porcine, rat)

CAS No.: 124123-15-5