PACAP-27 (human, mouse, ovine, porcine, rat) PACAP and Fragments Catalog

CAS	127317-03-7
Sequence	H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
Sequence Single	HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Molecular Formula	C142H224N40O39S
Molecular Weight	3147.65
Synonyms	Pituitary Adenylate Cyclase Activating Polypeptide-27 (human, mouse, ovine, porcine, rat), PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat)
Technology	Synthetic
Storage	-20°C, avoid light, cool and dry place
Application	Pituitary & Hypothalamic Hormones
Description	PACAP-27 (human, mouse, ovine, porcine, rat) also called Pituitary Adenylate Cyclase Activating Polypeptide-27 (human, mouse, ovine, porcine, rat), PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat), is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively.
References	1. Platelet-derived growth factor (PDGF) in oncogenesis: development of a vascular connective tissue stroma in xenotransplanted human melanoma producing PDGF-BB. K.Forsberg et al., Proc. Natl. Acad. Sci. USA, 90, 393 (1993) 2. The novel VIP-like hypothalamic polypeptide PACAP interacts with high affinity receptors in the human neuroblastoma cell line NB-OK. A.Cauvin et al., Peptides, 11, 773 (1990) 3. Developmental changes of pituitary adenylate cyclase activating polypeptide (PACAP) and its receptor in the rat brain. I.Tatsuno et al., Peptides, 15, 55 (1994) 4. Differential signal transduction by five splice variants of the PACAP receptor. D.Spengler et al., Nature, 365, 170 (1993) 5. Neuropeptide pituitary adenylate cyclase-activating polypeptide (PACAP) slows down Alzheimer’s disease-like pathology in amyloid precursor protein-transgenic mice. D.Rat et al., FASEB J., 25, 3208 (2011) 6. The two forms of the pituitary adenylate cyclase activating polypeptide (PACAP (1-27) and PACAP (1-38)) interact with distinct receptors on rat pancreatic AR 4-2J cell membranes. P.Robberecht et al., FEBS Lett., 286, 133 (1991) 7. Isolation of a neuropeptide corresponding to the N-terminal 27 residues of the pituitary adenylate cyclase activating polypeptide with 38 residues (PACAP38). A.Miyata et al., Biochem. Biophys. Res. Commun., 170, 643 (1990) 8. The neuropeptide PACAP promotes the alpha-secretase pathway for processing the Alzheimer amyloid precursor protein. E.Kojro et al., FASEB J., 20, 512 (2006) 9. A novel peptide which stimulates adenylate cyclase: molecular cloning and characterization of the ovine and human cDNAs. C.Kimura et al., Biochem. Biophys. Res. Commun., 166, 81 (1990) 10. Receptors for pituitary adenylate cyclase-activating polypeptide: comparison with vasoactive intestinal peptide receptors. A.Arimura, Trends Endocrinol. Metab., 3, 288 (1992)

PeptideDB

PACAP-27 (human, mouse, ovine, porcine, rat)

CAS No.: 127317-03-7