| CAS | 96827-05-3/106441-70-7 |
| Sequence | H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 |
| Sequence Single | DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2 |
| Molecular Formula | C175H284N52O52S |
| Molecular Weight | 3980.57 |
| Synonyms | Neuropeptide K, porcine |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cancer Research |
| Description | Neuropeptide K (human, porcine, rat) also called Neuropeptide K, porcine, is a brain tachykinin, it is also a major tachykinin in plasma and tumor tissues of carcinoid patients. |
| References | 1. Dermorphin analog Tyr-D-Arg2-Phe-sarcosine-induced opioid analgesia and respiratory stimulation: the role of mu 1-receptors? P.Paakkari et al., J. Pharmacol. Exp. Ther., 266, 544 (1993) 2. Neuropeptide K: a major tachykinin in plasma and tumor tissues from carcinoid patients. E.Theodorsson-Norheim et al., Biochem. Biophys. Res. Commun., 131, 77 (1985) |
Neuropeptide K (human, porcine, rat)
CAS No.: 96827-05-3/106441-70-7
Neuropeptide K (human, porcine, rat) also called Neuropeptide K, porcine, is a brain tachykinin, it is also a major tach
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.