| CAS | 145808-47-5 |
| Sequence | H-Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His-OH (Disulfide bonds between Cys7 and Cys29/Cys13 and Cys34/Cys17 and Cys36) |
| Sequence Single | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH |
| Molecular Formula | C178H286N52O50S7 |
| Molecular Weight | 4179.01 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Ion Channel Modulating Agents |
| Description | Margatoxin also called MgTX, originally isolated from the venom of the scorpion Centruroides margaritatus, is a peptidyl inhibitor of voltage dependent K+ channels in brain synaptic plasma membranes. Margatoxin is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). |
| References | 1. Design and characterization of a fluorogenic substrate selectively hydrolyzed by stromelysin 1 (matrix metalloproteinase-3). H.Nagase et al., J. Biol. Chem., 269, 20952 (1994) 2. Chemical synthesis and structure-function studies of margatoxin, a potent inhibitor of voltage-dependent potassium channel in human T lymphocytes. M.A.Bednarek et al., Biochem. Biophys. Res. Commun., 198, 619 (1994) 3. Margatoxin is a non-selective inhibitor of human Kv1.3 K+ channels. Bartok A, et al. Toxicon. 2014 Sep;87:6-16. 4. PreImplantation factor prevents atherosclerosis via its immunomodulatory effects without affecting serum lipids. Chen YC, et al. Thromb Haemost. 2016 May 2;115(5):1010-24. |