| CAS | 138068-37-8 |
| Sequence | H-Leu-Thr-Tyr-Thr-Asp-Cys-Thr-Glu-Ser-Gly-Gln-Asn-Leu-Cys-Leu-Cys-Glu-Gly-Ser-Asn-Val-Cys-Gly-Gln-Gly-Asn-Lys-Cys-Ile-Leu-Gly-Ser-Asp-Gly-Glu-Lys-Asn-Gln-Cys-Val-Thr-Gly-Glu-Gly-Thr-Pro-Lys-Pro-Gln-Ser-His-Asn-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-L |
| Sequence Single | LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
| Molecular Formula | C287H440N80O111S6 |
| Molecular Weight | 6979.52 |
| Synonyms | (Leu1,Thr2)-Hirudin (desulfated) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cardiovascular System & Diseases|Hematology |
| Description | Lepirudin also called (Leu1,Thr2)-Hirudin (desulfated), is a synthetic peptide. Lepirudin is an anticoagulant which functions as a direct thrombin inhibitor. |
| References | 1. Investigation of RNA-protein and RNA-metal ion interactions by electron paramagnetic resonance spectroscopy. The HIV TAR-Tat motif. T.E.Edwards et al., Chem. Biol., 9, 699 (2002) |