| CAS | 11061-68-0 |
| Sequence | H-Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn-OH H-Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr-OH* (Disulfide bridge between 6 - 11, 7 -7*, 20 - 19*) |
| Sequence Single | GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT*(Disulfide bridge between 6 - 11, 7 -7*, 20 - 19*) |
| Molecular Formula | C257H383N65O77S6 |
| Molecular Weight | 5807.57 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Insulin (human) recombinant expressed in yeast is an endogenous insulin receptor agonist (Ki = 4.85 nM). Insulin (human) recombinant expressed in yeast decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo. |
| References | 1. Age dependent changes of Ins receptors in rat tissues. Torlinska et al (2000). J.Physiol.Pharmacol. 51 871 PMID: 11220495 2. The binding characteristics of Ins-MTX to Ins receptor. Ou et al (2001). Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao. 32 538 PMID: 12528542 3. The molecular basis of Ins-stimulated glucose uptake: signalling, trafficking and potential drug targets. Leney and Tavare (2009). J.Endocrinol. 203 1 PMID: 19389739 |
Insulin (human) recombinant expressed in yeast
CAS No.: 11061-68-0
Insulin (human) recombinant expressed in yeast is an endogenous insulin receptor agonist (Ki = 4.85 nM). Insulin (human)
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.