| CAS | 1927927-11-4 |
| Sequence | H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH (Disulfide bond) |
| Sequence Single | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
| Molecular Formula | C266H381N67O76S2 |
| Molecular Weight | 5797.49 |
| Synonyms | Osteocalcin (1-49) (human) (decarboxylated) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes|Obesity Research |
| Description | (Glu17.21.24)-Osteocalcin (1-49) (human) also called Osteocalcin (1-49) (human) (decarboxylated). The peptide hormone osteocalcin is involved not only in bone formation, it also plays an important role in glucose metabolism and could regulate testosteron. In mice, only the completely decarboxylated form of the peptide shows the latter hormonal activities, whereas in humans, osteocalcin, partially decarboxylated osteocalcins, and the uncarboxylated peptide seem to be involved. Generally, obese individuals have been shown to have lower osteocalcin(s) levels than non-obese controls, and type 2 diabetic individuals have lower plasma osteocalcin than non-diabetic individuals. |
| References | 1. Smac, a mitochondrial protein that promotes cytochrome c-dependent caspase activation by eliminating IAP inhibition. C.Du et al., Cell, 102, 33 (2000) 2. Bone as a regulator of glucose metabolism. A.G.Veldhuis-Vlug et al., Neth. J. Med., 71, 396 (2013) 3. Bone Regulates Glucose Metabolism as an Endocrine Organ through Osteocalcin. J.Shao et al., Int. J. Endocrinol., 2015, 967673 (2015) 4. Lower uncarboxylated osteocalcin concentrations in children with prediabetes is associated with beta-cell function. N.K.Pollock et al., J. Clin. Endocrinol. Metab., 96, E1092 (2011) 5. The uncarboxylated form of osteocalcin is associated with improved glucose tolerance and enhanced beta-cell function in middle-aged male subjects. Y.C.Hwang et al., Diabetes. Metab. Res. Rev, 25, 768 (2009) 6. Bone as an endocrine organ. A.R.Guntur and C.J.Rosen, Endocr. Pract., 18, 758 (2012) |
(Glu17.21.24)-Osteocalcin (1-49) (human)
CAS No.: 1927927-11-4
(Glu17.21.24)-Osteocalcin (1-49) (human) also called Osteocalcin (1-49) (human) (decarboxylated). The peptide hormone os
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.