| CAS | 110084-95-2 |
| Sequence | H-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Glu-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-NH2 |
| Sequence Single | SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2 |
| Molecular Formula | C148H221N41O47S |
| Molecular Weight | 3358.7 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes |
| Description | (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) is potentially useful in the study of the pathogenesis of diabetes. |
| References | 1. Isolation and characterization of the bovine hypothalamic growth hormone releasing factor. F.Esch et al., Biochem. Biophys. Res. Commun., 117, 772 (1983) 2. Biological activities of des-His1[Glu9]glucagon amide, a glucagon antagonist. C.G.Unson et al., Peptides, 10, 1171 (1989) |
(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)
CAS No.: 110084-95-2
(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) is a potent and peptide antagonist of the glucagon receptor,
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.