| CAS | 163515-35-3 |
| Sequence | H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 (Disulfide bonds between Cys2 and Cys19/Cys5 and Cys28/Cys16 and Cys33/Cys20 and Cys35) |
| Sequence Single | MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH₂ |
| Molecular Formula | C158H249N53O47S11 |
| Molecular Weight | 3995.77 |
| Synonyms | Cltx (Egyptian scorpion) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cancer Research|Ion Channel Modulating Agents |
| Description | Chlorotoxin also called Cltx (Egyptian scorpion), is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker. |
| References | 1. Tumor paint: a chlorotoxin:Cy5.5 bioconjugate for intraoperative visualization of cancer foci. D.R.Griffin et al., Biomacromolecules, 14, 1199 (2013) 2. Chlorotoxin: Structure, activity, and potential uses in cancer therapy. M.Veiseh et al., Cancer Res., 67, 6882 (2007) 3. Platinum(IV)-chlorotoxin (CTX) conjugates for targeting cancer cells. P.G.Ojeda et al., Biopolymers, 106, 25 (2016) 4. Purification and characterization of chlorotoxin, a chloride channel ligand from the venom of the scorpion. DeBin JA, et al. Am J Physiol. 1993 Feb;264(2 Pt 1):C361-9. 5. Use of chlorotoxin for targeting of primary brain tumors. Soroceanu L, et al. Cancer Res. 1998 Nov 1;58(21):4871-9. 6. Chlorotoxin: a helpful natural scorpion peptide to diagnose glioma and fight tumor invasion. Dardevet L, et al. Toxins (Basel). 2015 Mar 27;7(4):1079-101. |