| CAS | 463930-25-8 |
| Sequence | H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2 |
| Sequence Single | HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2 |
| Molecular Formula | C167H270N52O46 |
| Molecular Weight | 3742.29 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Bay 55-9837 is a selective VPAC2 receptor agonist (EC50 values are 0.4, 100 and >1000 nM for VPAC2, VPAC1 and PAC1, respectively in a cAMP accumulation assay; IC50 values are 60, 8700 and >10000 nM for VPAC2, VPAC1 and PAC1, respectively in a competition binding assay). Bay 55-9837 stimulates glucose-dependent insulin secretion in isolated human pancreatic islets. Bay 55-9837 reduces HIV-1 viral replication and shows cooperative effects when given in conjunction with VPAC1 agonists. |
| References | 1. A potent and highly selective VPAC2 agonist enhances glucose-induced Ins release and glucose disposal: a potential therapy for type 2 diabetes. Tsutsumi et al (2002). Diabetes 51 1453 PMID: 11978642 2. Engineering of a VPAC2 receptor peptide agonist to impart dipeptidyl peptidase IV stability and enhance in vivo glucose disposal. Clairmont et al (2006). J.Med.Chem. 49 7545 PMID: 17149884 3. Engineering novel VPAC2-selective agonists with improved stability and glucose-lowering activity in vivo. Pan et al (2007). J.Pharmacol.Exp.Ther. 320 900 PMID: 17110523 4. Macrophage resistance to HIV-1 infection is enhanced by the neuropeptides VIP and PACAP. Temerozo et al (2013). PLoS ONE 8 67701 PMID: 23818986 |