| CAS | 60880-63-9 |
| Sequence | H-Gly-Val-Ser-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Thr-Leu-Trp-Leu-Tyr-Pro-Ser-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln-OH (Disulfide bonds between Cys4 and Cys46/Cys6 and Cys36/Cys29 and Cys47) |
| Sequence Single | GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ |
| Molecular Formula | C220H326N64O67S6 |
| Molecular Weight | 5131.8 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cardiovascular System & Diseases |
| Description | Anthopleurin-A also called AP-A, has been isolated from the sea anemone, Anthopleura xanthogrammica, and was found to have inotropic but no chronotropic effects on mammalian heart preparation. |
| References | 1. Natural histidine-containing dipeptide carnosine as a potent hydrophilic antioxidant with membrane stabilizing function. A biomedical aspect. A.A.Boldyrev et al., Mol. Chem. Neuropathol., 19, 185 (1993) 2. Amino acid sequence of the Anthopleura xanthogrammica heart stimulant, anthopleurin A. M.Tanaka et al., Biochemistry, 16, 204 (1977) 3. Cardiotonic effects of anthopleurin-A, a polypeptide from a sea anemone. A.Scriabine et al., J. Cardiovasc. Pharmacol., 1, 571 (1979) 4. Synthesis of the cardiac inotropic polypeptide anthopleurin-A. M.W.Pennington et al., Int. J. Pept. Protein Res., 43, 463 (1994) |