PeptideDB

Anthopleurin-A

CAS No.: 60880-63-9

Anthopleurin-A also called AP-A, has been isolated from the sea anemone, Anthopleura xanthogrammica, and was found to ha
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 60880-63-9
Sequence H-Gly-Val-Ser-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Thr-Leu-Trp-Leu-Tyr-Pro-Ser-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln-OH (Disulfide bonds between Cys4 and Cys46/Cys6 and Cys36/Cys29 and Cys47)
Sequence Single GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ
Molecular Formula C220H326N64O67S6
Molecular Weight 5131.8
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Cardiovascular System & Diseases
Description Anthopleurin-A also called AP-A, has been isolated from the sea anemone, Anthopleura xanthogrammica, and was found to have inotropic but no chronotropic effects on mammalian heart preparation.
References 1.  Natural histidine-containing dipeptide carnosine as a potent hydrophilic antioxidant with membrane stabilizing function. A biomedical aspect. A.A.Boldyrev et al., Mol. Chem. Neuropathol., 19, 185 (1993) 2.  Amino acid sequence of the Anthopleura xanthogrammica heart stimulant, anthopleurin A. M.Tanaka et al., Biochemistry, 16, 204 (1977) 3.  Cardiotonic effects of anthopleurin-A, a polypeptide from a sea anemone. A.Scriabine et al., J. Cardiovasc. Pharmacol., 1, 571 (1979) 4.  Synthesis of the cardiac inotropic polypeptide anthopleurin-A. M.W.Pennington et al., Int. J. Pept. Protein Res., 43, 463 (1994)