PeptideDB

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

CAS No.:

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an ACE (angiotensin-converting enzyme) 2 (ACE2)-related peptide that may b
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an ACE (angiotensin-converting enzyme) 2 (ACE2)-related peptide that may be utilized to study the function of ACE2.

Physicochemical Properties


Molecular Formula C213H342N58O66S2
Molecular Weight 4835.47
Appearance White to off-white solid powder
HS Tariff Code 2934.99.9001
Storage

Powder-20°C 3 years

4°C 2 years

In solvent -80°C 6 months

-20°C 1 month

Note: Please store this product in a sealed and protected environment, avoid exposure to moisture.
Shipping Condition Room temperature (This product is stable at ambient temperature for a few days during ordinary shipping and time spent in Customs)

Biological Activity



Solubility Data


Solubility (In Vitro) DMSO :~33.33 mg/mL (~6.89 mM)
Solubility (In Vivo) Solubility in Formulation 1: ≥ 2.5 mg/mL (0.52 mM) (saturation unknown) in 10% DMSO + 40% PEG300 + 5% Tween80 + 45% Saline (add these co-solvents sequentially from left to right, and one by one), clear solution.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 25.0 mg/mL clear DMSO stock solution to 400 μL PEG300 and mix evenly; then add 50 μL Tween-80 to the above solution and mix evenly; then add 450 μL normal saline to adjust the volume to 1 mL.
Preparation of saline: Dissolve 0.9 g of sodium chloride in 100 mL ddH₂ O to obtain a clear solution.

Solubility in Formulation 2: ≥ 2.5 mg/mL (0.52 mM) (saturation unknown) in 10% DMSO + 90% Corn Oil (add these co-solvents sequentially from left to right, and one by one), clear solution.
For example, if 1 mL of working solution is to be prepared, you can add 100 μL of 25.0 mg/mL clear DMSO stock solution to 900 μL of corn oil and mix evenly.

 (Please use freshly prepared in vivo formulations for optimal results.)
Preparing Stock Solutions 1 mg 5 mg 10 mg
1 mM 0.2068 mL 1.0340 mL 2.0681 mL
5 mM 0.0414 mL 0.2068 mL 0.4136 mL
10 mM 0.0207 mL 0.1034 mL 0.2068 mL
*Note: Please select an appropriate solvent for the preparation of stock solution based on your experiment needs. For most products, DMSO can be used for preparing stock solutions (e.g. 5 mM, 10 mM, or 20 mM concentration); some products with high aqueous solubility may be dissolved in water directly. Solubility information is available at the above Solubility Data section. Once the stock solution is prepared, aliquot it to routine usage volumes and store at -20°C or -80°C. Avoid repeated freeze and thaw cycles.