| Bioactivity | β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction[1][2]. |
| Name | β-Endorphin (rat) |
| CAS | 309246-19-3 |
| Sequence | Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln |
| Shortening | YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ |
| Formula | C157H254N42O44S |
| Molar Mass | 3466.02 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yamamoto T, et al. Effects of taste stimulation on beta-endorphin levels in rat cerebrospinal fluid and plasma. Physiol Behav. 2000 May;69(3):345-50. [2]. Roth-Deri I, et al. Beta-endorphin and drug-induced reward and reinforcement. Prog Neurobiol. 2008 Sep;86(1):1-21. |
β-Endorphin (rat)
CAS: 309246-19-3 F: C157H254N42O44S W: 3466.02
β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.