PeptideDB

Urocortin III, mouse

CAS: 357952-10-4 F: C186H312N52O52S2 W: 4172.97

Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and a
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2[1]. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics[2].
Name Urocortin III, mouse
CAS 357952-10-4
Sequence Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2
Shortening FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
Formula C186H312N52O52S2
Molar Mass 4172.97
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Identification of urocortin III, an add [2]. Shemesh Y, et al. Ucn3 and CRF-R2 in the medial amygdala regulate complex social dynamics. Nat Neurosci. 2016 Nov;19(11):1489-1496.