| Bioactivity | Tityustoxin-Kα (TsTx-Kα) is an inhibitor of potassium voltage-gated channels. Tityustoxin-Kα shows a dose-dependent block of the sustained outward current in cultured hippocampal neurons [1]. |
| Name | Tityustoxin-Kα |
| CAS | 152618-71-8 |
| Sequence | Val-Phe-Ile-Asn-Ala-Lys-Cys-Arg-Gly-Ser-Pro-Glu-Cys-Leu-Pro-Lys-Cys-Lys-Glu-Ala-Ile-Gly-Lys-Ala-Ala-Gly-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro (Disulfide bridge: Cys7-Cys28, Cys13-Cys33, Cys17-Cys35) |
| Shortening | VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP (Disulfide bridge: Cys7-Cys28, Cys13-Cys33, Cys17-Cys35) |
| Formula | C168H275N49O46S7 |
| Molar Mass | 3941.74 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. C U Eccles, et al. Tityustoxin-Kα, from scorpion venom, blocks voltage-gated, non-inactivating potassium current in cultured central neurons. Neuropharmacology. 1994, 33, 2. |
Tityustoxin-Kα
CAS: 152618-71-8 F: C168H275N49O46S7 W: 3941.74
Tityustoxin-Kα (TsTx-Kα) is an inhibitor of potassium voltage-gated channels. Tityustoxin-Kα shows a dose-dependent b
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.