| Bioactivity | SpHistin is an antimicrobial peptide (AMP). SpHistin can bind to LPS (HY-D1056) and permeabilize the bacterial membrane. SpHistin combined with Rifampicin (HY-B0272) and Azithromycin (HY-17506) promotes the intracellular uptake of the antibiotics and subsequently enhances the bactericidal activity of both agents against P. aeruginosa[1]. |
| Name | SpHistin |
| Sequence | Met-Ala-Gly-Gly-Lys-Ala-Gly-Lys-Asp-Ser-Gly-Lys-Ala-Lys-Ala-Lys-Ala-Val-Ser-Arg-Ser-Ala-Arg-Ala-Gly-Leu-Gln-Phe-Pro-Val-Gly-Arg-Ile-His-Arg-His-Leu-Lys |
| Shortening | MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLK |
| Formula | C170H293N61O45S |
| Molar Mass | 3943.59 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Jie Liu, et al. The Synergistic Effect of Mud Crab Antimicrobial Peptides Sphistin and Sph12-38 With Antibiotics Azithromycin and Rifampicin Enhances Bactericidal Activity Against Pseudomonas Aeruginosa. Front Cell Infect Microbiol. 2020 Oct 23:10:572849. |