| Bioactivity | RCP168 is a highly selective and affinity CXCR4 receptor antagonist (IC50=5 nM). RCP168 has a stronger ability than natural chemical factors to inhibit the entry of HIV-1 (human immunodeficiency virus type 1) into host cells via CXCR4 receptors. RCP168 inhibits HIV-1 infection by blocking viral binding sites or inducing receptor internalization. RCP168 can be used to analyze the interaction between CXCR4 receptor and other chemical factor receptors[1]. |
| Sequence | d-(Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys)-Cys-Cys-Leu-Gly-Tyr-Gln-Lys-Arg-Pro-Leu-Pro-Gln-Val-Leu-Leu-Ser-Ser-Trp-Tyr-Pro-Thr-Ser-Gln-Leu-Cys-Ser-Lys-Pro-Gly-Val-Ile-Phe-Leu-Thr-Lys-Arg-Gly-Arg-Gln-Val-Cys-Ala-Asp-Lys-Ser-Lys-Asp-Trp-Val-Lys-Lys-Leu-Met-Gln-Gln-Leu-Pro-Val-Thr-Ala-Arg (Disulfide bridge: Cys11-Cys35,Cys12-Cys51) |
| Shortening | d-(LGASWHRPDK)-CCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR (Disulfide bridge: Cys11-Cys35,Cys12-Cys51) |
| Formula | C365H585N105O95S5 |
| Molar Mass | 8124.52 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Liu D, et al. Crystal structure and structural mechanism of a novel anti-human immunodeficiency virus and D-amino acid-containing chemokine[J]. Journal of virology, 2007, 81(20): 11489-11498. |