Proadrenomedullin (45-92), human_product_DataBase

Bioactivity	Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products[1][2].
Name	Proadrenomedullin (45-92), human
CAS	166798-69-2
Sequence	Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val
Shortening	ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRV
Formula	C215H359N67O73S2
Molar Mass	5114.76
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Lorubbio M, et al. Midregional pro-adrenomedullin (MR-ProADM) reference values in serum. Clin Biochem. 2018 Mar;53:173-174. [2]. Al-Omari MA, et al. Mid-regional pro-adrenomedullin is associated with pulse pressure, left ventricular mass, and albuminuria in African Americans with hypertension. Am J Hypertens. 2009 Aug;22(8):860-6.

PeptideDB