| Bioactivity | PSM-β is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-β is an analog of staphylococcal toxins, as well as a termed phenol-soluble modulin. PSM-β has bacteriostatic and poorly hemolytic properties[1][2]. | ||||||
| Name | PSM-β | ||||||
| Sequence | Met-Ser-Lys-Leu-Ala-Glu-Ala-Ile-Ala-Asn-Thr-Val-Lys-Ala-Ala-Gln-Asp-Gln-Asp-Trp-Thr-Lys-Leu-Gly-Thr-Ser-Ile-Val-Asp-Ile-Val-Glu-Ser-Gly-Val-Ser-Val-Leu-Gly-Lys-Ile-Phe-Gly-Phe | ||||||
| Shortening | MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF | ||||||
| Formula | C208H338N52O65S | ||||||
| Molar Mass | 4639.28 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
||||||
| Reference | [1]. Mehlin C, et al. An inflammatory polypeptide complex from Staphylococcus epidermidis: isolation and characterization. J Exp Med. 1999 Mar 15;189(6):907-18. [2]. Marchand A, et al. Anti-Legionella activity of staphylococcal hemolytic peptides. Peptides. 2011 May;32(5):845-51. |