PNC-27_product_DataBase

Bioactivity	PNC-27 is an anticancer peptide, containing an HDM-2-binding domain. PNC-27 shows anti-tumor activity and can be used in acute myeloid leukemia research[1][2][3].
Invitro	PNC-27 (50 μg/mL; 0-3 h) induces cancer cell death[1].PNC-27 (50 μg/mL; 15 min) binds to cell membrane-bound HDM-2[1]. Cell Cytotoxicity Assay[1] Cell Line:
In Vivo	PNC-27 (intraperitoneal injection; 40 mg/kg; once daily; 2-3 w) shows anti-leukemia activity in vivo[2]. Animal Model:
Name	PNC-27
CAS	1159861-00-3
Shortening	PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Formula	C188H293N53O44S
Molar Mass	4031.73
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Sarafraz-Yazdi E, et al. Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Proc Natl Acad Sci U S A. 2010 Feb 2;107(5):1918-23. [2]. Wang H, et al. Targeting cell membrane HDM2: A novel therapeutic approach for acute myeloid leukemia. Leukemia. 2020 Jan;34(1):75-86. [3]. Sookraj KA, et al. The anti-cancer peptide, PNC-27, induces tumor cell lysis as the intact peptide. Cancer Chemother Pharmacol. 2010 Jul;66(2):325-31.

PeptideDB