PeptideDB

PACAP (1-38), human, ovine, rat

CAS: 137061-48-4 F: C203H331N63O53S W: 4534.26

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I recept
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
Invitro PACAP (1-38), human, ovine, rat is a fragment of pituitary adenylate cyclase activating polypeptide[1]. PACAP (1-38) shows high affinity for PACAP specific (PAC1) receptor in membranes from various tissues including the endocrine pancreas[2]. In vitro, PACAP (1-38) relaxes guinea-pig and rabbit tracheal smooth muscle precontracted by histamine and by acetylcholine. PACAP (1-38) also increases adenosine 3':5'-cyclic monophosphate (cyclic AMP) in tracheal smooth muscle, providing a possible mechanism for the relaxant effect of PACAP (1-38)[3].
Name PACAP (1-38), human, ovine, rat
CAS 137061-48-4
Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Shortening HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Formula C203H331N63O53S
Molar Mass 4534.26
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)