| Bioactivity | Oxyntomodulin, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist[1]. | ||||||
| Invitro | Oxyntomodulin is a peptide hormone released from the gut in post-prandial state that activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR) resulting in superior body weight lowering to selective GLP1R agonists. Oxyntomodulin is mainly produced in gut endocrine L-cells by processing of the preproglucagon precursor by prohormone convertase 1/3. Oxyntomodulin is a full agonist in cell lines over expressing the human GLP1R and GCGR-mediated cAMP accumulation although with reduced affinity compared to GLP-1 and glucagon[1]. | ||||||
| Name | Oxyntomodulin | ||||||
| CAS | 62340-29-8 | ||||||
| Shortening | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA | ||||||
| Formula | C192H295N59O60S | ||||||
| Molar Mass | 4421.86 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |