PeptideDB

Oxyntomodulin

CAS: 62340-29-8 F: C192H295N59O60S W: 4421.86

Oxyntomodulin, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist.
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Oxyntomodulin, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist[1].
Invitro Oxyntomodulin is a peptide hormone released from the gut in post-prandial state that activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR) resulting in superior body weight lowering to selective GLP1R agonists. Oxyntomodulin is mainly produced in gut endocrine L-cells by processing of the preproglucagon precursor by prohormone convertase 1/3. Oxyntomodulin is a full agonist in cell lines over expressing the human GLP1R and GCGR-mediated cAMP accumulation although with reduced affinity compared to GLP-1 and glucagon[1].
Name Oxyntomodulin
CAS 62340-29-8
Shortening HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Formula C192H295N59O60S
Molar Mass 4421.86
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)